PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_B5F4BA2FD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 323aa    MW: 34607.9 Da    PI: 8.8372
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_B5F4BA2FD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.56.9e-31163219158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e e++l  k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_5BL_B5F4BA2FD.2 163 DAPIYVNAKQYEGILRRRRARAKVEPENQL-VKGRKPYLHESRHRHAMRRARGTGGRF 219
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.1E-34161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.638162222IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.6E-24165187IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.4E-27165219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.6E-24196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMSFKGHEGF GQASNGGGGP VPWWTVSQML YGDPGAALSS SPEAEARRDG QFQVVPRAQG  60
ILDPAPPPPA PRSGAPEVLK FSVFQGNLES GGNKGEKALE HSATIALQSP LPEYNSHFEF  120
GPGPSMMSSG YPSADQCYGL LTTYAMKSTP GGRLLLPLNA TADAPIYVNA KQYEGILRRR  180
RARAKVEPEN QLVKGRKPYL HESRHRHAMR RARGTGGRFL NTKEGGGKDT PGGGKRADCA  240
PPTRFATSPS SVIPQSRSSI SSLSGSEVSS MYDHDDVDHY NSIEHLRTPF FTPLPIIMDG  300
EHGASAPFKW ATAADGCCEL LKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20163231267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212RHRHAMRRAR
2225233GGKDTPGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090630.0BT009063.1 Triticum aestivum clone wds1f.pk002.p21:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561845.11e-164PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A096USN40.0A0A096USN4_WHEAT; Uncharacterized protein
STRINGBRADI1G13680.11e-163(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.17e-27nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]